Purrple Academy bronze

purrpleacademy.com

“The first CPALE reviewer app with Taglish lessons for Filipino accountancy graduates preparing for the PRC Board Exam.

https://purrpleacademy.com/.well-known/agent-card.json its card

Checked 6d ago extensions, pushNotifications, streaming

we checked this the operator says this

Community rating 0 0 up · 0 down — sign in to vote

Verified by agenttru.st

Everything here is a check agenttru.st performed itself. Assurance, protocol, hosting and freshness are in the card above and are not repeated.

Certificate: Issued by Let's Encrypt domain-validated
Valid until 11 Dec 2026. A wildcard certificate: its other hosts are invisible here, because CT logs the wildcard, not them.

Control of the hostname was checked; nothing about who operates it.
DANE / TLSA: Not verified (TLSA query returned RCodeNameError)
Discovery: Well-known document
AI use policy: Search: yesAI training: nouse: reference

What this site's robots.txt says about how AI may use its content. Recorded as the operator wrote it, not enforced — these are preferences about use, not access, and agenttru.st only reads the agent's own discovery documents.
First seen: 8 Sep 2026

View verification details

Assurance: bronze Bronze — agent card fetched over HTTPS with a valid certificate
Protocols: A2A verified by handshake or card fetch, not merely advertised
Hosted in: ? Unknown · Cloudflare, Inc. (AS13335)
The address did not geolocate — usually anycast hosting, where one address answers from many places at once.
Last checked: 6d ago

What this agent says it can do

Declared in the agent's own card. agenttru.st has not tested whether it completes any of these tasks — the operator of purrpleacademy.com controls every word below.

CPALE Review

Study materials, 7,000+ practice questions, and preboard simulations for all 6 CPALE subjects: FAR, AFAR, MAS, TAX, RFBT, and Auditing.

cpalecpaboard-examaccountingphilippinesreviewfarafarmastaxrfbtauditing

CPALE Information

Explains Philippine CPA Licensure Examination requirements, passing criteria, exam schedule, and study strategies.

cpalerequirementsexam-infophilippinesaccountancyprc

Subscription Checkout

Subscribe to Purrple Academy Pro for full access to all review materials, practice questions, and preboard simulations.

subscriptionpaymentcheckoutprocommerce

Technical agent card

Copied from the agent's card. The operator controls these values; agenttru.st has not verified them.

Provider: Purrple Academy — what this agent says about itself; other agents claiming the same provider are not thereby related
Protocol: a2a
Version: 1.0.0
Extensions: AP2 https://ap2-protocol.org/ap2/specification/
Agent Payments Protocol (AP2) — cryptographic payment mandates for subscription purchases
AP2 https://github.com/google-agentic-commerce/AP2
Agent Payments Protocol (AP2) extension metadata for Purrple Academy subscriptions.

A2A protocol extensions the card declares. A declared payment extension (AP2, x402) means the operator says the agent can transact, not that agenttru.st has seen it do so.
Card completeness: complete all eight fields required by a2a.proto v1.0

View all card details

Capabilities: extensions pushNotifications streaming
Agent card: https://purrpleacademy.com/.well-known/agent-card.json

Operate this agent and would rather not be listed? Request removal.