Local Business Registry bronze

marketingregistry.org

“A2A agent registry for local and regional service businesses - dental and orthodontics, healthcare, insurance, legal, home services and trades, septic and sanitation, waste and hauling, moving and storage, real estate, food and hospitality, fitness, recreation, fire safety, and nonprofits. Published by TESSA Marketing & Technology. Powered by TESSA's MCP server, served via Streamable HTTP at /mcp/.

a2a https://marketingregistry.org/mcp/ talk to it https://marketingregistry.org/.well-known/agent-card.json its card

Checked 4h ago extensions, pushNotifications, streaming

we checked this the operator says this

Community rating 0 0 up · 0 down — sign in to vote

Verified by agenttru.st

Everything here is a check agenttru.st performed itself. Assurance, protocol, hosting and freshness are in the card above and are not repeated.

Certificate: Issued by Let's Encrypt domain-validated
Valid until 17 Jan 2027 as of our check on 15 Nov 2026. A wildcard certificate: its other hosts are invisible here, because CT logs the wildcard, not them.

Control of the hostname was checked; nothing about who operates it.

Key ECDSA P-256, signed ECDSA-SHA384, issued via YE1 under ISRG Root X2 — classical, as every publicly trusted certificate is today.

Names on this certificate (2)

*.marketingregistry.org, marketingregistry.org.
Connection: TLS 1.3 · X25519MLKEM768 — post-quantum hybrid key exchange, agreed with our checker on 15 Nov 2026. What this means
DANE / TLSA: Not verified
Discovery: Well-known document
First seen: 21 Aug 2026

View verification details

Assurance: bronze Bronze — agent card fetched over HTTPS with a valid certificate
Protocols: A2A verified by handshake or card fetch, not merely advertised
Hosted in: ? Unknown · Cloudflare, Inc. (AS13335)
The address did not geolocate — usually anycast hosting, where one address answers from many places at once.
Last checked: 4h ago

What this agent says it can do

Declared in the agent's own card. agenttru.st has not tested whether it completes any of these tasks — the operator of marketingregistry.org controls every word below.

Find a firm in the Local Business Registry

Search the Local Business Registry for vetted firms. Filter by sub-vertical, region, capability, accepting-new-clients status, and service-type slug. Returns matching firms with their slugs, websites, and locations.

directorysearchfirm-discoveryprofessional-servicesmarketingrfqrfpvendor-discovery

Get a Firm Profile

Returns the full dossier for a single firm in this registry: description, headquarters, founded year, employee band, services, locations, sub-vertical, taxonomy, and the TESSA Professional Services v1 extension payload.

directoryfirm-profiledossierextension-payloadmarketing

Request an Introduction

Request a warm introduction to a firm in this registry. TESSA logs the lead and forwards a structured intro email to the firm with TESSA Cc'd. No calendar booking.

leadwarm-introintroductiondirectorymarketing

Claim a Listing in this Registry

Record a firm's intent to claim its directory listing. Pre-OAuth this is a stub: TESSA logs the claim and a representative reaches out to verify the claimant within one business day.

claimownershipverificationdirectorylisting-controlmarketing

Request a Quote from a Listed Firm

Request a quote from any firm in this registry. Lighter-weight than request-introduction — explicitly framed as a budget+scope inquiry. Records to directory_leads and forwards to the firm.

quoterfqscopebudgetleaddirectorymarketing

Technical agent card

Copied from the agent's card. The operator controls these values; agenttru.st has not verified them.

Provider: TESSA Marketing & Technology — what this agent says about itself; other agents claiming the same provider are not thereby related
Protocol: a2a
Version: 1.0.0
Extensions: https://complianceregistry.net/extensions/tessa-professional-services/v1
TESSA Professional Services extension — Yelp-style metadata for regulated-services firms. Payload lives under _meta['tessa.professional_services.v1'].

A2A protocol extensions the card declares. A declared payment extension (AP2, x402) means the operator says the agent can transact, not that agenttru.st has seen it do so.
Card completeness: complete all eight fields required by a2a.proto v1.0

View all card details

Capabilities: extensions pushNotifications streaming
Agent card: https://marketingregistry.org/.well-known/agent-card.json

Operate this agent and would rather not be listed? Request removal.