agenttru.st

ifuri-connect bronze

connect.ifuri.com

“ifURI connector hub: URI routes for DNS, files, LLM, devices, processes and more — installable as urirun registries and projectable to MCP tools.

a2a https://connect.ifuri.com talk to it https://connect.ifuri.com/.well-known/agent-card.json its card
🇩🇪 DE · IONOS SE Checked 7d ago pushNotifications, stateTransitionHistory, streaming

we checked this    the operator says this

Community rating 0 0 up · 0 down — sign in to vote

Verified by agenttru.st

Everything here is a check agenttru.st performed itself. Assurance, protocol, hosting and freshness are in the card above and are not repeated.

Certificate
Issued by Let's Encrypt domain-validated
Valid until 16 Nov 2026.
Control of the hostname was checked; nothing about who operates it.
DANE / TLSA
Not verified (TLSA query returned RCodeNameError)
Discovery
Well-known document
First seen
25 Aug 2026
View verification details
Assurance
bronze Bronze — agent card fetched over HTTPS with a valid certificate
Protocols
A2A verified by handshake or card fetch, not merely advertised
Hosted in
🇩🇪 DE · IONOS SE (AS8560)
Last checked
7d ago

What this agent says it can do

Declared in the agent's own card. agenttru.st has not tested whether it completes any of these tasks — the operator of connect.ifuri.com controls every word below.

Planfile Tasks

Plan, group and execute daily tasks through task:// and planfile:// URI commands.

taskplanfiletaskstodosprintLLM workflow
Examples it gives
  • task://host/tickets/query/list
  • task://host/ticket/query/next
  • task://host/ticket/query/show
  • task://host/ticket/command/create
  • task://host/ticket/command/start
  • task://host/ticket/command/complete

SQLite Context Store

Local data, artifacts, checks and logs over data://, artifact://, check:// and log://.

dataartifactchecklogsqlitecontextlogsartifactsmemory
Examples it gives
  • data://host/datasets/query/list
  • data://host/dataset/command/create
  • data://host/record/command/upsert
  • data://host/records/query/search
  • data://host/sql/query/read-only
  • artifact://host/artifact/command/register

Domain Monitor

HTTP, DNS reads, screenshots, logs and daily domain checks through URI commands.

monitorbrowserflowlogdomainmonitoringDNSHTTPoperations
Examples it gives
  • monitor://host/http/query/status
  • monitor://host/dns/query/current
  • monitor://host/dns/query/expected
  • browser://host/page/command/screenshot
  • log://host/daily/command/write
  • log://host/logs/query/recent

HTTP Check

Check HTTP endpoints through httpcheck:// URI commands and a small Python CLI.

httpcheckhttpstatusmonitoringsmoke testconnector
Examples it gives
  • httpcheck://host/http/query/status

Time Tools

Expose current time and timezone checks through time:// URI commands.

timetimezoneclockworkflowconnector
Examples it gives
  • time://host/clock/query/now

Namecheap DNS

Safe DNS query, plan, backup and apply flow for Namecheap host records.

dnsNamecheapDNSrecordsdomainAPI
Examples it gives
  • dns://host/records/query/current
  • dns://host/records/query/expected
  • dns://host/records/command/plan
  • dns://host/records/command/backup
  • dns://host/records/command/apply

gRPC Transport

Expose and call URI registries over gRPC for service-to-service communication.

transportgRPCserviceregistryruntime
Examples it gives
  • transport://grpc/service/command/serve

MQTT Device Bridge

Publish, subscribe and bridge firmware/backend/frontend device commands through MQTT URI routes.

mqttdeviceMQTTfirmwareIoTtelemetry
Examples it gives
  • mqtt://broker/topic/command/publish
  • device://device-01/led/command/set

Browser Control

Drive browser/noVNC actions through browser:// URI commands for demos and QA.

browserscreenshotQAnoVNCautomation
Examples it gives
  • browser://desktop/page/command/open
  • browser://desktop/page/command/screenshot

Base64 (PHP)

Encode and decode text with Base64 through codec:// URI commands.

codecbase64phppolyglotconnector
Examples it gives
  • codec://host/text/query/base64

Camera capture + OCR

Turn a USB/built-in webcam into data over camera:// URIs: discover cameras, beep before scan, capture a still frame, describe what is in the photo, find and crop to the dominant object, OCR it, and run simple inspection/alert rules. Capture uses ffmpeg (OpenCV optional); scene understanding + object detection reuse the img2nl engine via urirun-connector-ocr (Pillow edge/stats fallback); OCR uses tesseract, upgrading to the richer OCR connector backends automatically.

camerawebcamcapturephotoocrtesseractffmpegobject-detectionscene-descriptionimg2nlcropv4l2usbbeepinspectionalertmotion-detectionchange-detectionaudit
Examples it gives
  • camera://host/devices/query/list
  • camera://host/photo/command/capture
  • camera://host/photo/query/describe
  • camera://host/photo/query/analyze
  • camera://host/photo/query/inspect
  • camera://host/photo/query/compare

Chat Bridge

Deprecated chat bridge — map transcript to URI and forward to urisys RDP stack.

chatchat bridgetellmeshcapability packuri
Examples it gives
  • chat://local/message/command/send
  • chat://local/uri/command/execute

Document text / OCR

Extract text from PDFs and images over doc:// URIs. Text-layer PDFs use pdftotext; scans/images fall back through an OCR chain (tesseract, RapidOCR/ONNX from wronai-img2nl, or an Ollama vision model from wronai-ocr). Degrades gracefully to pdftotext-only.

dococrpdfpdftotextrapidocrtesseractinvoicedocumenttext
Examples it gives
  • doc://host/file/query/text
  • doc://host/file/query/ocr
  • doc://host/engine/query/list

Email

Read inbox, send mail, and extract local Thunderbird invoice attachments through email:// URI routes (IMAP + SMTP + local mbox).

emailimapsmtpthunderbirdinvoicemboxcommunicationconnector
Examples it gives
  • email://host/inbox/query/list
  • email://host/message/query/read
  • email://host/message/command/send
  • email://host/local/thunderbird/query/extract_invoices

Environment

Controlled env:// runtime configuration and secrets.

envenvironmenttellmeshcapability packuri
Examples it gives
  • env://runtime/query/health
  • env://runtime/query/list
  • env://runtime/config/query/startup
  • env://runtime/var/name/query/exists
  • env://runtime/var/name/query/value
  • env://runtime/secret/name/query/masked

Flow Repair

Generate a urirun flow (YAML) from natural language, execute it, and self-repair from failures via an LLM.

flowllmaiyamlrepairagentconnector
Examples it gives
  • flow://host/repair/command/run

Filesystem duplicates

Find duplicate files in any folder over fs:// URIs. Exact byte duplicates by SHA-256 (stdlib) and near-duplicate IMAGES by perceptual hash (reusing wronai-img2nl analyze_fingerprint). A move command quarantines extras into _duplicates/, keeping the first of each group.

fsduplicatesdedupesha256perceptual-hashphashimagehashfilesysteminvoice
Examples it gives
  • fs://host/duplicates/query/find
  • fs://host/duplicates/command/move

Get Node

Bootstrap and health-check urirun nodes from get.ifuri.com through node:// URI routes.

nodeinstallerbootstrapprovisioninghealth
Examples it gives
  • node://get/installer/query/script
  • node://host/runtime/query/health

GitHub

Clone git repos and deploy them anywhere via bindings/registry over github:// URI routes.

githubgitclonedeploybootstrapregistryconnector
Examples it gives
  • github://host/repo/command/clone
  • github://host/package/command/install
  • github://host/repo/query/bindings

Hash (Go)

Compute SHA-256 digests of text through hash:// URI commands.

hashsha256gopolyglotconnector
Examples it gives
  • hash://host/text/query/sha256

Human-in-the-Middle

Human input mock (mouse/keyboard) for urisys-node.

himhuman-in-the-middletellmeshcapability packuri
Examples it gives
  • him://host/mouse/query/status
  • him://host/mouse/command/move
  • him://host/mouse/command/click
  • him://host/mouse/command/scroll
  • him://host/keyboard/command/type
  • him://host/keyboard/command/type-text

Screen to Language

Screen capture + UI target detection via img2nl (KVM eyes).

img2nlscreen to languagetellmeshcapability packuri
Examples it gives
  • img2nl://host/screen/command/capture-click
  • img2nl://host/image/latest/command/click
  • img2nl://host/image/latest/query/targets

Invoice field extraction

Extract structured fields from invoices over invoice:// URIs — NIP, number, dates, net/VAT/gross, seller, currency. Regex tuned for Polish faktura (also EN), text via pdftotext, optional LLM (OpenRouter) fallback. A folder route batches a month of invoices into a CSV with net/VAT/gross totals.

invoicefakturanipvataccountingksiegowoscocrextraction
Examples it gives
  • invoice://host/file/query/parse
  • invoice://host/folder/query/audit

KSeF 2.0

Polish national e-invoicing (KSeF 2.0) as ksef:// routes: auth, send invoice, query, download.

ksefe-invoicingfakturygovernmentpolandconnector
Examples it gives
  • ksef://demo/auth/challenge
  • ksef://demo/cert/enroll
  • ksef://demo/cert/enrollment-data
  • ksef://demo/cert/limits
  • ksef://demo/invoice/{ksefNumber}
  • ksef://demo/invoices/query

KVM Control

Send keyboard/mouse input and capture the screen through kvm:// URI routes.

kvmKVMremoteinputkeyboardmousescreen
Examples it gives
  • kvm://host/input/command/key
  • kvm://host/input/command/move
  • kvm://host/screen/query/capture

Local LLM

Run local LLM completions and list models through llm:// URI routes.

llmLLMAIOllamaqweninferencelocal
Examples it gives
  • llm://host/chat/command/complete
  • llm://host/model/query/list

MCP Filesystem

Read, list and write files through fs:// URI routes backed by the MCP filesystem server.

fsMCPfilesystemfilesreadwriteagent
Examples it gives
  • fs://host/file/query/read
  • fs://host/dir/query/list
  • fs://host/file/command/write

Messaging

Simple alert/message dispatch mock for lab and node.

messagemessagingtellmeshcapability packuri
Examples it gives
  • message://local/alert/command/send

OCR

OCR text extraction from latest screenshot or image id (mock/tesseract).

ocrtellmeshcapability packuri
Examples it gives
  • ocr://host/image/latest/query/text
  • ocr://host/image/image_id/query/text

RDP Desktop

RDP session and X11 display queries for urirdp-docker.

rdprdp desktoptellmeshcapability packuri
Examples it gives
  • rdp://host/session/query/status
  • rdp://host/session/query/display
  • rdp://host/display/query/status
  • rdp://host/session/command/prepare-target
  • rdp://host/session/command/dismiss-target

Screen Capture

Screen capture — frame query, single capture, capture loop.

screenscreen capturetellmeshcapability packuri
Examples it gives
  • screen://target/monitor/monitor/query/frame
  • screen://target/monitor/monitor/command/capture
  • screen://target/capture/command/loop

Spreadsheet I/O (XLSX/CSV)

Read and write XLSX/CSV over sheet:// URIs without libreoffice. CSV via stdlib (always works); XLSX via openpyxl (pure Python). Reads return {columns, rows}; writes take rows and pick CSV/XLSX from the extension, with an optional totals footer. Pairs with invoice://ksef:// to emit accountant-ready Excel.

sheetxlsxcsvexcelopenpyxlspreadsheetaccountingksiegowoscbank-statement
Examples it gives
  • sheet://host/file/query/read
  • sheet://host/file/command/write
  • sheet://host/file/query/info

Stepper Motor

Stepper motor URI pack (mock + rpi-gpio-step-dir drivers).

stepperstepper motortellmeshcapability packuri
Examples it gives
  • stepper://device/axis/axis/query/status
  • stepper://device/axis/axis/command/enable
  • stepper://device/axis/axis/command/disable
  • stepper://device/axis/axis/command/stop
  • stepper://device/axis/axis/command/home
  • stepper://device/axis/axis/command/move-relative

Speech to Text

Speech-to-text pack (mock MVP; browser passthrough + audio transcribe).

sttspeech to texttellmeshcapability packuri
Examples it gives
  • stt://local/session/session/command/start
  • stt://local/session/session/query/transcript
  • stt://local/audio/command/transcribe

Email

Mail mock/mailpit/smtp automation for urisys-node.

urimailemailtellmeshcapability packuri
Examples it gives
  • urimail://account/query/status
  • urimail://account/inbox/query/unread
  • urimail://account/message/command/compose
  • urimail://account/message/command/send
  • urimail://account/message/command/publish-post

Office Documents

Office document mock/writer/LibreOffice automation for urisys-node.

uriofficeoffice documentstellmeshcapability packuri
Examples it gives
  • urioffice://host/query/status
  • urioffice://host/document/command/open
  • urioffice://host/document/command/save
  • urioffice://host/document/command/export-pdf
  • urioffice://host/writer/command/render

USB devices

Enumerate and classify the USB devices plugged into a computer over usb:// URIs. Reads the kernel's sysfs view (no root, no extra deps), labels each device by USB class codes (camera/webcam, keyboard, mouse, audio, storage, hub, printer, bluetooth, serial, smart-card/security-key) and maps it to the /dev nodes it owns (/dev/video*, /dev/input/*, /dev/ttyUSB*, /dev/hidraw*).

usbdeviceshardwarecamerawebcamkeyboardmousehidlsusbsysfsv4l2security-keybluetooth
Examples it gives
  • usb://host/devices/query/list
  • usb://host/devices/query/find
  • usb://host/cameras/query/list
  • usb://host/input/query/list
  • usb://host/devices/query/probe

UUID (JavaScript)

Generate UUID v4 identifiers through uuid:// URI commands.

uuidjavascriptnodepolyglotconnector
Examples it gives
  • uuid://host/id/query/v4

Visual Query

Visual query language — UI detect/compare for urisys-node.

vqlvisual querytellmeshcapability packuri
Examples it gives
  • vql://host/ui/latest/query/detect
  • vql://host/ui/latest/query/compare

WebRTC

WebRTC session — HTTP signaling inbox (node) and DataChannel URI envelopes; browser P2P via ifURI /api/webrtc/signal.

webrtctellmeshcapability packuri
Examples it gives
  • webrtc://local/session/session/command/start
  • webrtc://local/session/session/data/command/send
  • webrtc://local/session/session/signal/command/post
  • webrtc://local/session/session/signal/query/inbox

Technical agent card

Copied from the agent's card. The operator controls these values; agenttru.st has not verified them.

Provider
if-uri — what this agent says about itself; other agents claiming the same provider are not thereby related
Protocol
a2a
Version
0.1.0
Card completeness
a2a.proto v1.0 requires eight top-level fields. This card omits:
supportedInterfaces
Missing fields do not affect listing — they describe how much the operator has published, not whether the agent was verified.
View all card details
Capabilities
pushNotifications stateTransitionHistory streaming
Agent card
https://connect.ifuri.com/.well-known/agent-card.json

Operate this agent and would rather not be listed? Request removal.